Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Verminephrobacter eiseniae Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A1WMU7

Expression Region

1-277

Origin

Verminephrobacter eiseniae (strain EF01-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIYPPIDPVALQIGPLAIHWYGLSYLAAFGLFMLLGCRRLRHPPFAGRTGPGAWSRKDV EDILFLGVAGVVLGGRLGYCLFYKPDYYLGHPLEVFALWQGGMAFHGGLLGVIVAMLWFA HSRQRPLLQVADFVAPCVPTGLAAGRVGNFINGELWGRFASPDLPWGMVFAHSGSMQPRH PSQVYQFLLEGLLLFVLLWLYARRERRQGQVAAAFLVGYGVLRFIAEQFREPDAFLGILA LGMSMGQWLCLPMIAGGVLLWCRAARRRPAVARGSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCH-L3 Rabbit mAb
E38A4320 100 µg -100 µL

UCH-L3 Rabbit mAb

Sign In for Pricing
View Details
Mouse Chrna7 / Neuronal acetylcholine receptor subunit alpha-7 Recombinant Protein
R9618m 1 Each

Mouse Chrna7 / Neuronal acetylcholine receptor subunit alpha-7 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Goblet Cells Antibody (FIS 3G12/3) [DyLight 680]
NBP2-50414FR 0.1 mL

Mouse Monoclonal Goblet Cells Antibody (FIS 3G12/3) [DyLight 680]

Sign In for Pricing
View Details
Mouse 25 Hydroxyvitamin D3 (25 (OH) D3) ELISA Kit
orb2811228-01 48 Tests

Mouse 25 Hydroxyvitamin D3 (25 (OH) D3) ELISA Kit

Sign In for Pricing
View Details
Mouse 25 Hydroxyvitamin D3 (25 (OH) D3) ELISA Kit
orb2811228-02 96 Tests

Mouse 25 Hydroxyvitamin D3 (25 (OH) D3) ELISA Kit

Sign In for Pricing
View Details
Mouse 25 Hydroxyvitamin D3 (25 (OH) D3) ELISA Kit
orb2811228-03 5 x 96 T

Mouse 25 Hydroxyvitamin D3 (25 (OH) D3) ELISA Kit

Sign In for Pricing
View Details