Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Verminephrobacter eiseniae Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A1WMU7

Expression Region

1-277

Origin

Verminephrobacter eiseniae (strain EF01-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIYPPIDPVALQIGPLAIHWYGLSYLAAFGLFMLLGCRRLRHPPFAGRTGPGAWSRKDV EDILFLGVAGVVLGGRLGYCLFYKPDYYLGHPLEVFALWQGGMAFHGGLLGVIVAMLWFA HSRQRPLLQVADFVAPCVPTGLAAGRVGNFINGELWGRFASPDLPWGMVFAHSGSMQPRH PSQVYQFLLEGLLLFVLLWLYARRERRQGQVAAAFLVGYGVLRFIAEQFREPDAFLGILA LGMSMGQWLCLPMIAGGVLLWCRAARRRPAVARGSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Formin-2 (FMN2) ELISA Kit
EIA07344m 1 Kit

Mouse Formin-2 (FMN2) ELISA Kit

Sign In for Pricing
View Details
Fn1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K5021502 1.0 µg DNA

Fn1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Chicken Polyclonal CCDC69 Antibody [FITC]
NBP1-77145F 0.1 mL

Chicken Polyclonal CCDC69 Antibody [FITC]

Sign In for Pricing
View Details
May & Grunwald's Stain For Microscopy
01640 00025 25 g

May & Grunwald's Stain For Microscopy

Sign In for Pricing
View Details
FOXO3 (NM_201559) Human Over-expression Lysate
LH16514V 100 µg

FOXO3 (NM_201559) Human Over-expression Lysate

Sign In for Pricing
View Details
GDC 0152
TRC-G299920-100MG 100 mg

GDC 0152

Sign In for Pricing
View Details