Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Micrococcus luteus Undecaprenyl-diphosphatase (uppP)

This Recombinant Micrococcus luteus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

C5CBT8

Expression Region

1-277

Origin

Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTWIEAIILGLVQGLTEFLPISSSAHIRIVGEFLPSATDPGAAFTAITQLGTELAVLIYF WRDITRIIGRWSAAVTGRIPHSDPDARMGWLIIVGSIPIAVLGLLLEDWIDTEFRSLWIT ATMLIVFGVLLALADRLGRQTKPLEKLTVRDGVLYGLAQALALIPGVSRSGGTIAAGLAM GYTRPAATRYAFLLAVPAVFASGLYKLYTSLTDPGTQGPYGMGETLVATAVAFVVAYAVI AWLMRFISTNSYLPFVWYRILLGGVLFALLGAGVISA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215G-01 20 Tests

PE/Cyanine5 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215G-02 100 Tests

PE/Cyanine5 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
REPS2 Rabbit Polyclonal Antibody
TA338177 100 µL

REPS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPIRE2 (KIAA1832, SPIR2) discontinued
514520 100 µg

SPIRE2 (KIAA1832, SPIR2) discontinued

Sign In for Pricing
View Details
Recombinant Human GRIN2A Protein, N-His
YHG32001 100 μg

Recombinant Human GRIN2A Protein, N-His

Sign In for Pricing
View Details