Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Natronomonas pharaonis Digeranylgeranylglyceryl phosphate synthase (NP4470A)

This Recombinant Natronomonas pharaonis Digeranylgeranylglyceryl phosphate synthase (NP4470A) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

Q3INH7

Expression Region

1-277

Origin

Natronomonas pharaonis (strain DSM 2160 / ATCC 35678)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERVRGLVELLRPGNAVAAGGLTFIGAFVAGGLSSPQSMAFAVVATVLATGAGNAINDYF DRDIDAINEPDRPIPRGAVSPRGALVYSVALFAVAVVLTLLLPWLAIAIAAINLVALVAY TEVFKGLPGVGNALVAYLTGSTFLYGGAAVGGDLAAVVVLFALAACATMAREIVKDVEDI DGDRAEGLRTLPIVIGERRSLYVAAGFVVVAVLSSPLPYLLGLFGWVYLVVLVPALCGLA AATWRSFSDPTTGQAWLKASMFAAAVAFVIGRLAVVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR3 (TLR3, Toll-like receptor 3, CD_antigen=CD283) (FITC) discontinued
031297-FITC 100 µL

TLR3 (TLR3, Toll-like receptor 3, CD_antigen=CD283) (FITC) discontinued

Sign In for Pricing
View Details
Monkey Tissue Inhibitor of Metalloproteinases 1 ELISA kit
GTR10474027 96 Well

Monkey Tissue Inhibitor of Metalloproteinases 1 ELISA kit

Sign In for Pricing
View Details
TBC1D10C Protein Vector (Human) (pPB-N-His)
PV041286 500 ng

TBC1D10C Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CCM2L Rabbit Polyclonal Antibody
orb3071797-01 30 µL

CCM2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCM2L Rabbit Polyclonal Antibody
orb3071797-02 50 µL

CCM2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCM2L Rabbit Polyclonal Antibody
orb3071797-03 100 µL

CCM2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details