Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q82NI4

Expression Region

1-277

Origin

Streptomyces avermitilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVINVGQAVVLGAVEGVTEFLPVSSTGHLKITEGLMGIPVDDNAVVGFSAVIQVGAIAA VLVYFFKDIVRIVSAWGRGLRNRDERHHHDYKFAWWVIYATIPIVIVGLAAKSLIEGPLA SLWVVAASLIVGSGVMWAADQMGRHKRGEDDTSFKDAMLVGSSQILALLFPGFSRSGATM STALILDLDRVAATRLSFFLGIPALTGAGLYELKDALGTGVGVAPLAVGTIVSFVVAYGS ISWLLKFVAKHSFNAFVIYRIVIGVLLLGLLGTGVLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raptor (RPTOR) Rabbit Polyclonal Antibody
TA392621 100 µL

Raptor (RPTOR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Phenoxybenzoic Acid
TRC-P228010-5G 5 g

3-Phenoxybenzoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS636728 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562137 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF640R conjugate, 0.1mg/mL
BNC402955-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Bdh2 activation kit by CRISPRa
GA208316 1 Kit

Mouse Bdh2 activation kit by CRISPRa

Sign In for Pricing
View Details