Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q82NI4

Expression Region

1-277

Origin

Streptomyces avermitilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVINVGQAVVLGAVEGVTEFLPVSSTGHLKITEGLMGIPVDDNAVVGFSAVIQVGAIAA VLVYFFKDIVRIVSAWGRGLRNRDERHHHDYKFAWWVIYATIPIVIVGLAAKSLIEGPLA SLWVVAASLIVGSGVMWAADQMGRHKRGEDDTSFKDAMLVGSSQILALLFPGFSRSGATM STALILDLDRVAATRLSFFLGIPALTGAGLYELKDALGTGVGVAPLAVGTIVSFVVAYGS ISWLLKFVAKHSFNAFVIYRIVIGVLLLGLLGTGVLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFA (Tumor Necrosis Factor alpha, TNFa, Tumor Necrosis Factor, Cachectin, TNF-alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFSF2) (HRP) discontinued
138449-HRP 100 µL

TNFA (Tumor Necrosis Factor alpha, TNFa, Tumor Necrosis Factor, Cachectin, TNF-alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFSF2) (HRP) discontinued

Sign In for Pricing
View Details
GYG1P3 Recombinant Protein (Human)
RP061569 100 µg

GYG1P3 Recombinant Protein (Human)

Sign In for Pricing
View Details
Benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate
JH837783 1 Each

Benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate

Sign In for Pricing
View Details
RRAGC Rabbit Polyclonal Antibody (BF594)
orb2554790 100 µL

RRAGC Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rat Ttc12 Pre-designed siRNA Set A
SI215338A 1 Each

Rat Ttc12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NTRK2 Recombinant Protein C-Fc Tag Lyophilized
MBS8434451-01 0.1 mg

NTRK2 Recombinant Protein C-Fc Tag Lyophilized

Sign In for Pricing
View Details