Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q82NI4

Expression Region

1-277

Origin

Streptomyces avermitilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVINVGQAVVLGAVEGVTEFLPVSSTGHLKITEGLMGIPVDDNAVVGFSAVIQVGAIAA VLVYFFKDIVRIVSAWGRGLRNRDERHHHDYKFAWWVIYATIPIVIVGLAAKSLIEGPLA SLWVVAASLIVGSGVMWAADQMGRHKRGEDDTSFKDAMLVGSSQILALLFPGFSRSGATM STALILDLDRVAATRLSFFLGIPALTGAGLYELKDALGTGVGVAPLAVGTIVSFVVAYGS ISWLLKFVAKHSFNAFVIYRIVIGVLLLGLLGTGVLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK4 Antibody Blocking peptide
orb1446976 500 µg

PANK4 Antibody Blocking peptide

Sign In for Pricing
View Details
FCRL1 Protein Vector (Mouse) (pPB-N-His)
PV179011 500 ng

FCRL1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CNTN4 Rabbit pAb
MBS8547861-01 0.1 mL

CNTN4 Rabbit pAb

Sign In for Pricing
View Details
CNTN4 Rabbit pAb
MBS8547861-02 0.1 mL (AF405L)

CNTN4 Rabbit pAb

Sign In for Pricing
View Details
CNTN4 Rabbit pAb
MBS8547861-03 0.1 mL (AF405S)

CNTN4 Rabbit pAb

Sign In for Pricing
View Details
CNTN4 Rabbit pAb
MBS8547861-04 0.1 mL (AF610)

CNTN4 Rabbit pAb

Sign In for Pricing
View Details