Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Lactobacillus delbrueckii subsp. bulgaricus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q93FD1

Expression Region

1-277

Origin

Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLALNPIAFSIGDIHVRWYGIIIACGILLATFMSIREGQRRQIMSDDFIDLLLWGVPIG FIGARIYYVIFEWGYFSQHPDEIIAIWNGGIAIYGGLIAGAIVLLVFCYRRFLPPFLVLD IVAPGVMAAQVLGRWGNFMNQEAHGAKCSLQYLQNLHLPQFIIDQMYINGSYYKPTFLYE SFFNLIGLIIILSLRHKKHLFKQGEVFMLYLAWYSVVRFFVEGMRTDSLYIFGVIRVSQA LSLLLLIAVVILFVYRRVKVKPKWYLEGSGLKYPYER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (NKI-C3), CF405S conjugate, 0.1mg/mL
BNC040186-500 1x 500 µL

CD63 (NKI-C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL
BNC682312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF568 conjugate, 0.1mg/mL
BNC682221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL
BNC041757-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details