Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus abyssi Digeranylgeranylglyceryl phosphate synthase (PYRAB00300)

This Recombinant Pyrococcus abyssi Digeranylgeranylglyceryl phosphate synthase (PYRAB00300) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

Q9V2P5

Expression Region

1-277

Origin

Pyrococcus abyssi (strain GE5 / Orsay)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKAFIEIMRPHNCILAGVVGILGSLVAYEGIPSIEKLGLVFLVVYLGCSAGNTINDYF DVEIDRVNRPNRPIPRGAIPRKVALYYALLQYMLGLALARFLGVEALLFALGAYALTFIY AWKLKPLPFIGNVAVALLTAATPIYGALGVGRVGLAGYLAICAFLVNVSREIMKDIEDIE GDMKMGAKTLPIIIGKRRAAMISSIFGVLTVITSFLPVKVGIGLGYAPIILVDAMILKAS IDVVKNPESASKGQKTLKIATFIAVISFLLGALTKGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Porcine Serine/Threonine-Protein Phosphatase PP1-Alpha Catalytic Subunit (PPP1CA) Monoclonal Antibody
VD12N590 1 Each

Mouse Anti-Porcine Serine/Threonine-Protein Phosphatase PP1-Alpha Catalytic Subunit (PPP1CA) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial
CSB-EP018353EEB-01 10 µg

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

Sign In for Pricing
View Details
Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial
CSB-EP018353EEB-02 50 µg

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

Sign In for Pricing
View Details
Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial
CSB-EP018353EEB-03 200 µg

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

Sign In for Pricing
View Details
Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial
CSB-EP018353EEB-04 500 µg

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

Sign In for Pricing
View Details
Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial
CSB-EP018353EEB-05 20 µg

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

Sign In for Pricing
View Details