Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Digeranylgeranylglyceryl phosphate synthase (MmarC6_0995)

This Recombinant Methanococcus maripaludis Digeranylgeranylglyceryl phosphate synthase (MmarC6_0995) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A9A8Y7

Expression Region

1-278

Origin

Methanococcus maripaludis (strain C6 / ATCC BAA-1332)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIKAYFELIRLKNCLTASFGAFIGGLIASYFNISMIDNLILASIVVFLVCGFGNALNDI YDLKIDKINKPKRPIPSKRISLGEARIFSYLLVVMGLIISMFNITCFLMAVLNSIVLQQY ASTYKKNKIVGNLIVAYLTGSVFIFGGIAVGNIDVTIMLFLCALFAMWSREIIKDYEDIE GDIKEKVISIPIKCGEKSIYIAAFLLVFAVLLSPLPYLFGFFGIYYLISVIFCDLLFLIG IYNLVMNPSKKEAKKASRNIKIVTNLVLIAFLIGSLFK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gm13003 activation kit by CRISPRa
GA219502 1 Kit

Mouse Gm13003 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-SSB/La Antibody Human ELISA Kit
B5712 96 Tests

Anti-SSB/La Antibody Human ELISA Kit

Sign In for Pricing
View Details
Cow Retinoid Isomerohydrolase (RPE65) ELISA Kit
abx555831 96 Tests

Cow Retinoid Isomerohydrolase (RPE65) ELISA Kit

Sign In for Pricing
View Details
DNAJC25 Polyclonal Antibody, Cy3 Conjugated
bs-14389R-Cy3-01 20 µL

DNAJC25 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
DNAJC25 Polyclonal Antibody, Cy3 Conjugated
bs-14389R-Cy3-02 100 µL

DNAJC25 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560778 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details