Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Digeranylgeranylglyceryl phosphate synthase (MmarC6_0995)

This Recombinant Methanococcus maripaludis Digeranylgeranylglyceryl phosphate synthase (MmarC6_0995) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A9A8Y7

Expression Region

1-278

Origin

Methanococcus maripaludis (strain C6 / ATCC BAA-1332)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIKAYFELIRLKNCLTASFGAFIGGLIASYFNISMIDNLILASIVVFLVCGFGNALNDI YDLKIDKINKPKRPIPSKRISLGEARIFSYLLVVMGLIISMFNITCFLMAVLNSIVLQQY ASTYKKNKIVGNLIVAYLTGSVFIFGGIAVGNIDVTIMLFLCALFAMWSREIIKDYEDIE GDIKEKVISIPIKCGEKSIYIAAFLLVFAVLLSPLPYLFGFFGIYYLISVIFCDLLFLIG IYNLVMNPSKKEAKKASRNIKIVTNLVLIAFLIGSLFK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1H3 Polyclonal Antibody
A55343-050 50 µL

NR1H3 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Urotensin-2 (UTS2) ELISA Kit
EK5923 48 Tests

Mouse Urotensin-2 (UTS2) ELISA Kit

Sign In for Pricing
View Details
MPP7 Rabbit pAb, Pacific Blue conjugated
orb2887760 100 µL

MPP7 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
ETNK2 antibody
70R-35529 0.1 mg

ETNK2 antibody

Sign In for Pricing
View Details
RPB4 Polyclonal Antibody
RA34570-01 50 µL

RPB4 Polyclonal Antibody

Sign In for Pricing
View Details
RPB4 Polyclonal Antibody
RA34570-02 100 µL

RPB4 Polyclonal Antibody

Sign In for Pricing
View Details