Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coxiella burnetii UPF0761 membrane protein CbuG_0433 (CbuG_0433)

This Recombinant Coxiella burnetii UPF0761 membrane protein CbuG_0433 (CbuG_0433) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

UPF0761 membrane protein CbuG_0433

UniProt

B6J454

Expression Region

1-278

Origin

Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212) )

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIYRFFKRSAFTLAYIYRRFHEEGCAYRATALAYTTLLALVPLTIVAFTLLSFVPAFQG VGVRLQNLIWENFVPTSAGMVAAYLSQLTQNVTGLSIINIFFLGIVALLLMYNINRAFVA IWHTEHHFRLSLHFLIYFMVLLLSPFLLGAVMLLGTFLVQSPLVTDLIGWPYLGKGLLFV LPYVLIFITFTLFNWVLPSAKVKLSHAVIGGLVTTVLFELAKFAFTVYLKFFPTYRVIYG ALSVIPIFLVWLYVSWTIILLGAVVSNVIACGIPEKYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-100 1x 100 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF594 conjugate, 0.1mg/mL
BNC941960-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details