Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 45B (Tmem45b)

This Recombinant Mouse Transmembrane protein 45B (Tmem45b) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q8VCZ2

Expression Region

1-278

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGSFFLIVGLWWSVKYPLKYFHHKGLKNNRLSRQQERIEIIEGAVKTLFAI IGILAEQFVPDGPHLHLYHENQWVKLMNWQHSTMYLFFGVSGLMDMITYLYFHIVPLGLD RVVLAMAVFIEGFLFYFHVHNRPPLDQHIHSLLLFGLFGAAVSISLEVILRDNIVLELFR TSLLILQGTWFWQIGFVLFPPFGRPEWDQKDMDNIMFITMCFCWHYLVALCIVAINYSLV YCFLTRVKRRAEGEIIGIQKLKSDHTYQSALLSGSDEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caly (NM_001190386) Mouse Tagged ORF Clone Lentiviral Particle
MR202674L4V 200 µL

Caly (NM_001190386) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SEC23A Immunizing Peptide
orb59734 100 µg

SEC23A Immunizing Peptide

Sign In for Pricing
View Details
Pseudomonas HiVeg® Agar Base
MV085-500G 500 g

Pseudomonas HiVeg® Agar Base

Sign In for Pricing
View Details
CHST2, NT (GST-2, GN6ST, Carbohydrate sulfotransferase 2, N-acetylglucosamine 6-O-sulfotransferase 1, GlcNAc6ST-1, Gn6ST-1)
310893-01 50 µg

CHST2, NT (GST-2, GN6ST, Carbohydrate sulfotransferase 2, N-acetylglucosamine 6-O-sulfotransferase 1, GlcNAc6ST-1, Gn6ST-1)

Sign In for Pricing
View Details
CHST2, NT (GST-2, GN6ST, Carbohydrate sulfotransferase 2, N-acetylglucosamine 6-O-sulfotransferase 1, GlcNAc6ST-1, Gn6ST-1)
310893-02 100 µg

CHST2, NT (GST-2, GN6ST, Carbohydrate sulfotransferase 2, N-acetylglucosamine 6-O-sulfotransferase 1, GlcNAc6ST-1, Gn6ST-1)

Sign In for Pricing
View Details
PEX7 CRISPRa sgRNA lentivector (set of three targets)(Rat)
36421126 3x 1.0µg DNA

PEX7 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details