Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 45B (Tmem45b)

This Recombinant Mouse Transmembrane protein 45B (Tmem45b) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q8VCZ2

Expression Region

1-278

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGSFFLIVGLWWSVKYPLKYFHHKGLKNNRLSRQQERIEIIEGAVKTLFAI IGILAEQFVPDGPHLHLYHENQWVKLMNWQHSTMYLFFGVSGLMDMITYLYFHIVPLGLD RVVLAMAVFIEGFLFYFHVHNRPPLDQHIHSLLLFGLFGAAVSISLEVILRDNIVLELFR TSLLILQGTWFWQIGFVLFPPFGRPEWDQKDMDNIMFITMCFCWHYLVALCIVAINYSLV YCFLTRVKRRAEGEIIGIQKLKSDHTYQSALLSGSDEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit
MBS167938-01 48 Well

Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit
MBS167938-02 96 Well

Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit
MBS167938-03 5x 96 Well

Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit
MBS167938-04 10x 96 Well

Human Soluble Cluster of differentiation 23 (sCD23), ELISA Kit

Sign In for Pricing
View Details
FAM105B/OTULIN Recombinant Protein Antigen
NBP2-14722PEP 0.1 mL

FAM105B/OTULIN Recombinant Protein Antigen

Sign In for Pricing
View Details
Kcnmb4 sgRNA CRISPR Lentivector set (Rat)
K7102001 3x 1.0 µg

Kcnmb4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details