Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 45B (Tmem45b)

This Recombinant Rat Transmembrane protein 45B (Tmem45b) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q497B2

Expression Region

1-278

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGSFFLIFGLWWSVKYPLKYFHQKGLKKNRLSLQQQRIEIIEGAVKALFAV IGILAEQFVPDGPHLHLYHENQWTKLMNWQHSTMYLFFGVSGIIDMLTYLYFNIVPLGLD RVVLAMAVFVEGFLFYFHVHGRPPLDQHIHSLLLFSLFGATISICLEVILRDNIVLELFR TTLLILQGTWFWQIGFVLFPPFGTPEWDQKDMDNVMFITMCFCWHYLVALCITAINYSLV YCFLTRVRRRAEGEIIGIQKLKSDHTYQSTLLSGSDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-catenin (phospho-Tyr333) Antibody
orb43357-01 50 μL

β-catenin (phospho-Tyr333) Antibody

Sign In for Pricing
View Details
β-catenin (phospho-Tyr333) Antibody
orb43357-02 100 µL

β-catenin (phospho-Tyr333) Antibody

Sign In for Pricing
View Details
Lentiviral human MED15 shRNA (UAS) - Lentiviral human MED15 shRNA (UAS) (100)
GTR15293985 1 Vial

Lentiviral human MED15 shRNA (UAS) - Lentiviral human MED15 shRNA (UAS) (100)

Sign In for Pricing
View Details
Crygf Protein Vector (Mouse) (pPB-N-His)
PV168259 500 ng

Crygf Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
VDI sgRNA CRISPR Lentivector (Human) (Target 1)
K2609102 1.0 µg DNA

VDI sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
2- (Pyridin-2-Yloxy) Benzylamine Hydrochloride
288145-01 25 mg

2- (Pyridin-2-Yloxy) Benzylamine Hydrochloride

Sign In for Pricing
View Details