Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 45B (Tmem45b)

This Recombinant Rat Transmembrane protein 45B (Tmem45b) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q497B2

Expression Region

1-278

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGSFFLIFGLWWSVKYPLKYFHQKGLKKNRLSLQQQRIEIIEGAVKALFAV IGILAEQFVPDGPHLHLYHENQWTKLMNWQHSTMYLFFGVSGIIDMLTYLYFNIVPLGLD RVVLAMAVFVEGFLFYFHVHGRPPLDQHIHSLLLFSLFGATISICLEVILRDNIVLELFR TTLLILQGTWFWQIGFVLFPPFGTPEWDQKDMDNVMFITMCFCWHYLVALCITAINYSLV YCFLTRVRRRAEGEIIGIQKLKSDHTYQSTLLSGSDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FLCN Protein Lysate
MBS8411816-01 0.02 mg

Human FLCN Protein Lysate

Sign In for Pricing
View Details
Human FLCN Protein Lysate
MBS8411816-02 5x 0.02 mg

Human FLCN Protein Lysate

Sign In for Pricing
View Details
FBLN2 Rabbit Polyclonal Antibody
orb2955003-01 50 µg

FBLN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBLN2 Rabbit Polyclonal Antibody
orb2955003-02 100 µg

FBLN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CLL1 (Collectin Liver 1) ELISA Kit
MBS2509073-01 24 Tests (Limit 1)

Human CLL1 (Collectin Liver 1) ELISA Kit

Sign In for Pricing
View Details
Human CLL1 (Collectin Liver 1) ELISA Kit
MBS2509073-02 48 Tests

Human CLL1 (Collectin Liver 1) ELISA Kit

Sign In for Pricing
View Details