Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. Cobalamin synthase (cobS)

This Recombinant Frankia sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q2J8A4

Expression Region

1-278

Origin

Frankia sp. (strain CcI3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMLEARTAFTLLTVLPLRGPEHTDRRLAGRAMALAPFVGLALGLLAGSAVFATRIVTAVP GQRAQTLLPAVVGVTVLALVTRGLHLDGLADLGDGLGAWRARGRDRALEIMRESTIGAFG AIIVLFVVLLQVGALSTTISAHRGTLSILVAAMTSRLAATLACTGAVPPARPDGLGALVA GTVRTRDAALSFLAVCAVAALAGLLDFDGGGPGRALRAVLAVWVGTGVSFLLRRYLLTRF GGITGDILGGLIEITAAATLLVMAMTIPTPVLHTLGLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLGAP4 Human Over-expression Lysate
orb1343964 100 µg

DLGAP4 Human Over-expression Lysate

Sign In for Pricing
View Details
TUG-770
C03845 5 mg

TUG-770

Sign In for Pricing
View Details
(-) -Cholesterol sulfo-NHS succinate
sc-471090 10 mg

(-) -Cholesterol sulfo-NHS succinate

Sign In for Pricing
View Details
Human Forkhead Box Protein P1 ELISA Kit
MBS046798-01 48 Well

Human Forkhead Box Protein P1 ELISA Kit

Sign In for Pricing
View Details
Human Forkhead Box Protein P1 ELISA Kit
MBS046798-02 96 Well

Human Forkhead Box Protein P1 ELISA Kit

Sign In for Pricing
View Details
Human Forkhead Box Protein P1 ELISA Kit
MBS046798-03 5x 96 Well

Human Forkhead Box Protein P1 ELISA Kit

Sign In for Pricing
View Details