Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Bicarbonate transport system permease protein CmpB (cmpB)

This Recombinant Synechococcus elongatus Bicarbonate transport system permease protein CmpB (cmpB) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Bicarbonate transport system permease protein CmpB

UniProt

Q55106

Expression Region

1-278

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTARETRRNGSRPSGLKKWRQKLDGILLPLAGILGFLIIWQIFSSSGATRLPGPLSLFT EERTRELLLYPFLDRGGLDKGLFWQTIASLTRVAQGFSIAAIIGISVGILVGLNRQLNAM LDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAVWPILINTAEGVRQIPQDYNN VARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGIVGIGFFIWDA YQQNYVSDIILAVIYIGAVGLLLDRFVAWLQRWILRNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HID1 Antibody
orb1337612 100 µg

HID1 Antibody

Sign In for Pricing
View Details
Acyp1 3'UTR Lenti-reporter-Luc Vector
11300086 1.0 µg

Acyp1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PADI4 Mouse Monoclonal Antibody [Clone ID: LBI5E7]
AMM12709V 100 µL

PADI4 Mouse Monoclonal Antibody [Clone ID: LBI5E7]

Sign In for Pricing
View Details
CEA (B5) Monoclonal Antibody, RBITC Conjugated
bsm-1624M-RBITC-TR 20 µL

CEA (B5) Monoclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Nicainoprol 100mg
A12269-100 100 mg

Nicainoprol 100mg

Sign In for Pricing
View Details
MASP2 Recombinant Protein Antigen
NBP1-81259PEP 0.1 mL

MASP2 Recombinant Protein Antigen

Sign In for Pricing
View Details