Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Bicarbonate transport system permease protein CmpB (cmpB)

This Recombinant Synechococcus elongatus Bicarbonate transport system permease protein CmpB (cmpB) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Bicarbonate transport system permease protein CmpB

UniProt

Q55106

Expression Region

1-278

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTARETRRNGSRPSGLKKWRQKLDGILLPLAGILGFLIIWQIFSSSGATRLPGPLSLFT EERTRELLLYPFLDRGGLDKGLFWQTIASLTRVAQGFSIAAIIGISVGILVGLNRQLNAM LDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAVWPILINTAEGVRQIPQDYNN VARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGIVGIGFFIWDA YQQNYVSDIILAVIYIGAVGLLLDRFVAWLQRWILRNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF5B Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-24717R-BF750 100 µL

KIF5B Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
AMY2A, CT (AMY2A, Pancreatic alpha-amylase, 1,4-alpha-D-glucan glucanohydrolase) (MaxLight 490) discontinued
031857-ML490 100 µL

AMY2A, CT (AMY2A, Pancreatic alpha-amylase, 1,4-alpha-D-glucan glucanohydrolase) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (C2) - IHC-Prediluted
NBP2-48121 7 mL

Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (C2) - IHC-Prediluted

Sign In for Pricing
View Details
GDPD2 Polyclonal Antibody
A59214-050 50 µL

GDPD2 Polyclonal Antibody

Sign In for Pricing
View Details
Rit1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3366606 1.0 µg DNA

Rit1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Adrenergic Receptor Kinase, beta 1 (bARK1, B1 AR, ARK1 beta, G-Protein Coupled Receptor Kinase 2, GPCR K2, GRK2) (AP) discontinued
A0906-95C-AP 100 µL

Adrenergic Receptor Kinase, beta 1 (bARK1, B1 AR, ARK1 beta, G-Protein Coupled Receptor Kinase 2, GPCR K2, GRK2) (AP) discontinued

Sign In for Pricing
View Details