Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fusobacterium nucleatum subsp. nucleatum Cobalamin synthase (cobS)

This Recombinant Fusobacterium nucleatum subsp. nucleatum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8R666

Expression Region

1-278

Origin

Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGFLLLLSFMTRIPMPKTDYDEEKLGKSMKYFPVVGIIVGFILLFFCIIFNFILKNISY SAVLPLMIIVVILTDLITTGALHLDGLADTFDGIFSYRSKHKMLEIMKDSRLGSNGALAL ILYFLLKFILLFSLTIESREAAVYAIITYPVVSRFCSVVSCASSPYARGSGMGKTFVDNI KTCGLIVATVITLLYTIGMLFMPFILFTNYSLPMQFMIRSVLIIVIIVGLLALFAFAFSK LIERKIGGITGDTLGALLEISSLVYIFLFLVIPTFFIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS3 Antibody (C-term) Blocking Peptide
MBS9220733-01 0.5 mg

BCAS3 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
BCAS3 Antibody (C-term) Blocking Peptide
MBS9220733-02 5x 0.5 mg

BCAS3 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
MCM3 3'UTR Luciferase Stable Cell Line
TU013122 1.0 mL

MCM3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DNase gamma Rabbit pAb
orb2711631-01 50 µL

DNase gamma Rabbit pAb

Sign In for Pricing
View Details
DNase gamma Rabbit pAb
orb2711631-02 100 µL

DNase gamma Rabbit pAb

Sign In for Pricing
View Details
HSPD1P16 ORF Vector (Human) (pORF)
ORF021232 1.0 µg DNA

HSPD1P16 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details