Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina acetivorans Cobalamin synthase (cobS)

This Recombinant Methanosarcina acetivorans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8TS66

Expression Region

1-278

Origin

Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSYLLAFKSGFGFLTTIPVGISMEGIDELMKKIYFYPVVGAVLGLLIGAIAYIGQLIFP DPVLAALIMGSVYYFTGFNHLDGVTDMGDGFMAHGSHEKKIKALKDTTLGTGGVAFGMLV LLAFYGSIRSIQDEGINVFGSNLPLLMFASMFIAEVSAKQSMLTIAAFGKPLPRPENQAY PGLGEMTINGATRKNFLIGFIFGAFVCFLPFGLIGLIPYLAACISALVLLNRSYAHFGGL NGDGIGTANEIGRITALIIIAVTLELSLNTGGLEWTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL23 (IL23A) activation kit by CRISPRa
GA109875 1 Kit

Human IL23 (IL23A) activation kit by CRISPRa

Sign In for Pricing
View Details
CD10 (MME) (NM_000902) Human Over-expression Lysate
LY425018 100 µg

CD10 (MME) (NM_000902) Human Over-expression Lysate

Sign In for Pricing
View Details
Sinomenine Hydrochloride
TRC-S487500-250MG 250 mg

Sinomenine Hydrochloride

Sign In for Pricing
View Details
Phospho-NF-kB p65 (S536) Recombinant Rabbit monoclonal Antibody
HA723223 100 µL

Phospho-NF-kB p65 (S536) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human 2B4/CD244 Protein (His Tag)
PKSH032784-01 10 µg

Recombinant Human 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human 2B4/CD244 Protein (His Tag)
PKSH032784-02 50 µg

Recombinant Human 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details