Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina acetivorans Cobalamin synthase (cobS)

This Recombinant Methanosarcina acetivorans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8TS66

Expression Region

1-278

Origin

Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSYLLAFKSGFGFLTTIPVGISMEGIDELMKKIYFYPVVGAVLGLLIGAIAYIGQLIFP DPVLAALIMGSVYYFTGFNHLDGVTDMGDGFMAHGSHEKKIKALKDTTLGTGGVAFGMLV LLAFYGSIRSIQDEGINVFGSNLPLLMFASMFIAEVSAKQSMLTIAAFGKPLPRPENQAY PGLGEMTINGATRKNFLIGFIFGAFVCFLPFGLIGLIPYLAACISALVLLNRSYAHFGGL NGDGIGTANEIGRITALIIIAVTLELSLNTGGLEWTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTR1 (NM_001039707) Human Over-expression Lysate
LY421811 100 µg

ENTR1 (NM_001039707) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene AM HMBA
H10014.5G 5 g

Polystyrene AM HMBA

Sign In for Pricing
View Details
Human FGF22 activation kit by CRISPRa
GA108963 1 Kit

Human FGF22 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Biotin,  10nm
GAB-01-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Biotin, 10nm

Sign In for Pricing
View Details
Aasdhppt Mouse Gene Knockout Kit (CRISPR)
KN500592 1 Kit

Aasdhppt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NIPSNAP3A (NM_015469) Human Over-expression Lysate
LC402439 20 µg

NIPSNAP3A (NM_015469) Human Over-expression Lysate

Sign In for Pricing
View Details