Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus pentosaceus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Pediococcus pentosaceus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q03GY4

Expression Region

1-278

Origin

Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTLGALNPIAFNLGGIQVHWYGIIIASAVVLATILAVQEAKRRRIDPDSIYDLILWAL PVAIITARMYYVIFEWGYYQNHVDEIVRVWDGGIAIYGALIGAGIVVYLFCRANWIPVWL MLDIIAPVLIMAQGIGRWGNFMNQEAFGRITSLTFLQSLHLPHFIIQQMLIDGAYRQPTF LYESLWDILGFIVLMSLRHKKHLFKQGEVFLSYVIWYAFGRFFVEGMRTDSLMLLGIRVS QWLSVILFIGAIGILVFRRKSMRERLPDYLEGNQLSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]
TA800537AM 100 µL

ZSCAN4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]

Sign In for Pricing
View Details
CPSF4L Human Gene Knockout Kit (CRISPR)
KN425192 1 Kit

CPSF4L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C14orf180 (NM_001008404) Human Over-expression Lysate
LC423426 20 µg

C14orf180 (NM_001008404) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR16 (CFAP52) (NM_001080556) Human Over-expression Lysate
LC421105 20 µg

WDR16 (CFAP52) (NM_001080556) Human Over-expression Lysate

Sign In for Pricing
View Details
Spatc1l Mouse Gene Knockout Kit (CRISPR)
KN516567 1 Kit

Spatc1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL
BNC402074-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details