Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus pentosaceus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Pediococcus pentosaceus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q03GY4

Expression Region

1-278

Origin

Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTLGALNPIAFNLGGIQVHWYGIIIASAVVLATILAVQEAKRRRIDPDSIYDLILWAL PVAIITARMYYVIFEWGYYQNHVDEIVRVWDGGIAIYGALIGAGIVVYLFCRANWIPVWL MLDIIAPVLIMAQGIGRWGNFMNQEAFGRITSLTFLQSLHLPHFIIQQMLIDGAYRQPTF LYESLWDILGFIVLMSLRHKKHLFKQGEVFLSYVIWYAFGRFFVEGMRTDSLMLLGIRVS QWLSVILFIGAIGILVFRRKSMRERLPDYLEGNQLSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42EP1 Rabbit Monoclonal Antibody
TA422818 100 µL

CDC42EP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710061 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
ABCG5 Rabbit Polyclonal Antibody
TA373152 100 µL

ABCG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715665 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human KLHL26 activation kit by CRISPRa
GA110682 1 Kit

Human KLHL26 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Prostein (SLC45A3) activation kit by CRISPRa
GA113875 1 Kit

Human Prostein (SLC45A3) activation kit by CRISPRa

Sign In for Pricing
View Details