Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sphingomonas wittichii Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Sphingomonas wittichii Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A5V5N0

Expression Region

1-279

Origin

Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQAVIANAAQAIHWADLGLNPIALDLGFLQIHWYSLAYISGILLGWYYLTRLIAQPGAP MARRHADDLVFYATLGILIGGRLAYVFFYQPDILLHPLDVLKLWQGGMSFHGGALGVAAG IFYMARRNGLSWLRIHDYVACCAPFGLFFGRIANFVNGELWGRPTDVSWAMIFPGAPDGL PRHPSQLYEAGLEGIVLGLVLSFFFWRTDARNQPGKLVGIFLLGYGLSRFVVEYFREPDA QLGTLSWGLTMGQTLTVPMLIGGLYLIATASKRTPINAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details