Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP)

This Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q46L84

Expression Region

1-279

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPEDISRYLFICFKSIFLGIIQGFTEFLPISSTAHLKVVPYLFGWNDLGVSFSASIQLGS AVAIIYYFRNHISLIINSFFSSFNPSKGFKDENSRLFLYIFVASIPILVFGLLIKLYWPN YSDSNLRGLFSIAITSIVMALLLALSEIYGKRNKLFVDINLNDVIKLGLAQSLALFPGVS RSGITLTSALFSGIERKTAARLSFLVGIPAVSISGLVELFSLFRVLSVIDIIPIIIGIIS SFFSSIFAIDLFLKFLSKNNTLVFVYYRLAFGIFILTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ISCU Antibody
MBS4514268-01 0.05 mL

Rabbit anti-ISCU Antibody

Sign In for Pricing
View Details
Rabbit anti-ISCU Antibody
MBS4514268-02 0.1 mL

Rabbit anti-ISCU Antibody

Sign In for Pricing
View Details
Rabbit anti-ISCU Antibody
MBS4514268-03 5x 0.1 mL

Rabbit anti-ISCU Antibody

Sign In for Pricing
View Details
Nephrocystin-5 Antibody
orb2626257 100 µL

Nephrocystin-5 Antibody

Sign In for Pricing
View Details
Goat anti-CD3D (isoform A) Antibody
orb198485 100 µg

Goat anti-CD3D (isoform A) Antibody

Sign In for Pricing
View Details
Anti-CLU [SAIC-43B-8]
orb1089974 0.2 mg

Anti-CLU [SAIC-43B-8]

Sign In for Pricing
View Details