Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrate transport permease protein nrtB (nrtB)

This Recombinant Nitrate transport permease protein nrtB (nrtB) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Nitrate transport permease protein nrtB

UniProt

Q51881

Expression Region

1-279

Origin

Phormidium laminosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTADLSSPRRARRSPSSYLGALVGKTIRRSIPTAIAFFVLLGIWQLLCSGENAACRPIQV VQESWDLIIDPFYRGSGTDQGLFWQIAASLQRVAVGYLMAAIAGIALGILIGVSVLMFQA LDPIFQVLRTVPPLAWLPISLAAFRDSQPAAIFVIFITAIWPIIINTAVGVQNIPQDYNN VARVLKLSRLDYFLKVLLPATVPYIFTGLKIAIGLSWLAIVAAEMLTGGVGIGFFIWDAY NSGSNSEVILAIIYVGLVGLLLNALVGFIASRVVPDEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spastin (Sp 3G11-1), CF405S conjugate, 0.1mg/mL
BNC042844-500 1x 500 µL

Spastin (Sp 3G11-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L1CAM Polyclonal Antibody
E-AB-16230-01 20 µL

L1CAM Polyclonal Antibody

Sign In for Pricing
View Details
L1CAM Polyclonal Antibody
E-AB-16230-02 60 µL

L1CAM Polyclonal Antibody

Sign In for Pricing
View Details
L1CAM Polyclonal Antibody
E-AB-16230-03 120 µL

L1CAM Polyclonal Antibody

Sign In for Pricing
View Details
L1CAM Polyclonal Antibody
E-AB-16230-04 200 µL

L1CAM Polyclonal Antibody

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Fmoc Amino PEG
133000-22-35.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Fmoc Amino PEG

Sign In for Pricing
View Details