Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrate transport permease protein nrtB (nrtB)

This Recombinant Nitrate transport permease protein nrtB (nrtB) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Nitrate transport permease protein nrtB

UniProt

Q51881

Expression Region

1-279

Origin

Phormidium laminosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTADLSSPRRARRSPSSYLGALVGKTIRRSIPTAIAFFVLLGIWQLLCSGENAACRPIQV VQESWDLIIDPFYRGSGTDQGLFWQIAASLQRVAVGYLMAAIAGIALGILIGVSVLMFQA LDPIFQVLRTVPPLAWLPISLAAFRDSQPAAIFVIFITAIWPIIINTAVGVQNIPQDYNN VARVLKLSRLDYFLKVLLPATVPYIFTGLKIAIGLSWLAIVAAEMLTGGVGIGFFIWDAY NSGSNSEVILAIIYVGLVGLLLNALVGFIASRVVPDEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v6 (Marker of Tumor Metastasis) (2F10), CF568 conjugate, 0.1mg/mL
BNC681629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Pancreas
CD564282 5 µg

Tissue Genomic DNA, Pancreas

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), CF488A conjugate, 0.1mg/mL
BNC881063-100 1x 100 µL

VEGF-A (VEGF/1063), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Small Cell Lung Cancer (SCLC) (MOC-52), CF640R conjugate, 0.1mg/mL
BNC400329-100 1x 100 µL

Small Cell Lung Cancer (SCLC) (MOC-52), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RNF187 activation kit by CRISPRa
GA115717 1 Kit

Human RNF187 activation kit by CRISPRa

Sign In for Pricing
View Details
Iprovalicarb-d8
TRC-I747502-25MG 25 mg

Iprovalicarb-d8

Sign In for Pricing
View Details