Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q8D2N5

Expression Region

1-279

Origin

Wigglesworthia glossinidia brevipalpis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNCYLAFPKYDPIIFSVGRFSAHWYGLMYLIGFYFIMWSSIKRYKLISLNKEKIENILY FSFLNALIGGRIGYVIFYKTKEIFFNPYFIFKVWEGGMSFHGGLLGSIISIYYFSKKYNC KFFKISDFLVPLIPFGLGFGRIGNFINGELWGRVNTSFCFTMLFPGSYDEDVKFLLNNPH LQDVFDKYHLLPRHISQLYEMFLEGILLFIILNIFEKKKKPTGYMSGLFLILYGSFRIIA EFFRQPDPQIGLMFNYISLGQILSIPMILYGLILIINSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINK2 (NM_021114) Human Tagged ORF Clone Lentiviral Particle
RC205388L3V 200 µL

SPINK2 (NM_021114) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human ALKBH5 qPCR Primer Pair
QH43393S 200 Tests

Human ALKBH5 qPCR Primer Pair

Sign In for Pricing
View Details
Ribophorin 2 (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 63kD Subunit, Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase Subunit 2, Ribophorin II, Ribophorin-2, RPN-II, RIBIIR, RPN2) (FITC)
MBS6392543-01 0.1 mL

Ribophorin 2 (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 63kD Subunit, Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase Subunit 2, Ribophorin II, Ribophorin-2, RPN-II, RIBIIR, RPN2) (FITC)

Sign In for Pricing
View Details
Ribophorin 2 (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 63kD Subunit, Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase Subunit 2, Ribophorin II, Ribophorin-2, RPN-II, RIBIIR, RPN2) (FITC)
MBS6392543-02 5x 0.1 mL

Ribophorin 2 (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 63kD Subunit, Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase Subunit 2, Ribophorin II, Ribophorin-2, RPN-II, RIBIIR, RPN2) (FITC)

Sign In for Pricing
View Details
UBE2D3 Recombinant Rabbit mAb
BS46137-01 50 µL

UBE2D3 Recombinant Rabbit mAb

Sign In for Pricing
View Details
UBE2D3 Recombinant Rabbit mAb
BS46137-02 100 µL

UBE2D3 Recombinant Rabbit mAb

Sign In for Pricing
View Details