Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q8D2N5

Expression Region

1-279

Origin

Wigglesworthia glossinidia brevipalpis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNCYLAFPKYDPIIFSVGRFSAHWYGLMYLIGFYFIMWSSIKRYKLISLNKEKIENILY FSFLNALIGGRIGYVIFYKTKEIFFNPYFIFKVWEGGMSFHGGLLGSIISIYYFSKKYNC KFFKISDFLVPLIPFGLGFGRIGNFINGELWGRVNTSFCFTMLFPGSYDEDVKFLLNNPH LQDVFDKYHLLPRHISQLYEMFLEGILLFIILNIFEKKKKPTGYMSGLFLILYGSFRIIA EFFRQPDPQIGLMFNYISLGQILSIPMILYGLILIINSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STN 673-297X105-B7541 Personal Protection (PPE) Signs & Labels (Adhesive)
251269 1 Card (1 Panel (s) x 1 Pack)

STN 673-297X105-B7541 Personal Protection (PPE) Signs & Labels (Adhesive)

Sign In for Pricing
View Details
HNRNPA3P2 sgRNA CRISPR Lentivector set (Human)
K0977101 3x 1.0 µg

HNRNPA3P2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TRPM7 Rabbit Polyclonal Antibody (BF594)
orb1811664 100 µL

TRPM7 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Recombinant Human Probable exonuclease mut-7 homolog, isoform 5 (EXD3)
MBS1456474-01 0.02 mg (E-Coli)

Recombinant Human Probable exonuclease mut-7 homolog, isoform 5 (EXD3)

Sign In for Pricing
View Details
Recombinant Human Probable exonuclease mut-7 homolog, isoform 5 (EXD3)
MBS1456474-02 0.1 mg (E-Coli)

Recombinant Human Probable exonuclease mut-7 homolog, isoform 5 (EXD3)

Sign In for Pricing
View Details
Recombinant Human Probable exonuclease mut-7 homolog, isoform 5 (EXD3)
MBS1456474-03 0.02 mg (Yeast)

Recombinant Human Probable exonuclease mut-7 homolog, isoform 5 (EXD3)

Sign In for Pricing
View Details