Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor A8 (V1ra8)

This Recombinant Mouse Vomeronasal type-1 receptor A8 (V1ra8) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor A8

UniProt

Q9EQ48

Expression Region

1-279

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKDHTLYCSVYIRNAFFSEIGIGISANSCLLLFHTFMFIRGHRPRLTDLPIGFVALIHL VMLLLAAYITEDFFMSSGGWDDITCKLVIFLHRFFRSLSVCATCLLSVFQAIILCPQSSH LAKLKQNSPHQLSYFFIFLSIFYTSISSQILIAAIPTQNITFVNLIYITNSCSFLPLSSS MQHTFSTLLTFRNVFVIGLMGLSTCYMATLLCRHKTRSQRLQNSKLSPKATPEQRALRTI LMLMSFFLLMSTFDSIISYSRTIITGKSTALLCPDSCRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kanamycin Monosulfate EZ Pak™ for 50 mg/mL Solution
K-120-EZ25-25mL 25 mL

Kanamycin Monosulfate EZ Pak™ for 50 mg/mL Solution

Sign In for Pricing
View Details
Recombinant Shewanella loihica Dihydroxy-acid dehydratase (ilvD), partial
MBS1016779 Inquire

Recombinant Shewanella loihica Dihydroxy-acid dehydratase (ilvD), partial

Sign In for Pricing
View Details
Clindamycin Sulfoxide
006937 2.5 mg

Clindamycin Sulfoxide

Sign In for Pricing
View Details
APPL2, NT (APPL2, DIP13B, DCC-interacting protein 13-beta, Adapter protein containing PH domain, PTB domain and leucine zipper motif 2) (FITC)
MBS6274591-01 0.2 mL

APPL2, NT (APPL2, DIP13B, DCC-interacting protein 13-beta, Adapter protein containing PH domain, PTB domain and leucine zipper motif 2) (FITC)

Sign In for Pricing
View Details
APPL2, NT (APPL2, DIP13B, DCC-interacting protein 13-beta, Adapter protein containing PH domain, PTB domain and leucine zipper motif 2) (FITC)
MBS6274591-02 5x 0.2 mL

APPL2, NT (APPL2, DIP13B, DCC-interacting protein 13-beta, Adapter protein containing PH domain, PTB domain and leucine zipper motif 2) (FITC)

Sign In for Pricing
View Details
5I-dUTP
M-NU-120S 50 μL

5I-dUTP

Sign In for Pricing
View Details