Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor A8 (V1ra8)

This Recombinant Mouse Vomeronasal type-1 receptor A8 (V1ra8) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor A8

UniProt

Q9EQ48

Expression Region

1-279

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKDHTLYCSVYIRNAFFSEIGIGISANSCLLLFHTFMFIRGHRPRLTDLPIGFVALIHL VMLLLAAYITEDFFMSSGGWDDITCKLVIFLHRFFRSLSVCATCLLSVFQAIILCPQSSH LAKLKQNSPHQLSYFFIFLSIFYTSISSQILIAAIPTQNITFVNLIYITNSCSFLPLSSS MQHTFSTLLTFRNVFVIGLMGLSTCYMATLLCRHKTRSQRLQNSKLSPKATPEQRALRTI LMLMSFFLLMSTFDSIISYSRTIITGKSTALLCPDSCRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC35E4 Antibody Picoband®, FITC Conjugate
A18522-FITC 100 µg/Vial

Anti-SLC35E4 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase A5 (PDIA5)
MBS1351507-01 0.02 mg (E-Coli)

Recombinant Human Protein disulfide-isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase A5 (PDIA5)
MBS1351507-02 0.02 mg (Yeast)

Recombinant Human Protein disulfide-isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase A5 (PDIA5)
MBS1351507-03 0.1 mg (E-Coli)

Recombinant Human Protein disulfide-isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase A5 (PDIA5)
MBS1351507-04 0.1 mg (Yeast)

Recombinant Human Protein disulfide-isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase A5 (PDIA5)
MBS1351507-05 0.02 mg (Baculovirus)

Recombinant Human Protein disulfide-isomerase A5 (PDIA5)

Sign In for Pricing
View Details