Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG135 (MG135)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG135 (MG135) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Uncharacterized protein MG135

UniProt

P47381

Expression Region

1-280

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTLNYLVIILIIAGVISVLAFTPLVRKLKIRFYLIQVLAIVLFVYVFFGRQIIYLFPDV YGQNSQSSQNLDSLRLSRIFLLDLCPFFAVIAPVFVFLKQKKISGVLAVFGLFGALVTLF GELIFTPVNEQDIVNFIFVGTGNNQIYFMMHFLSLLVSLAIILWDNCFSLISFFYIHVFA LIYFSYVALMVSVFKGQITGNTTGILASDWTNGEYKNVATFLNLSNSDPQLVFIVGFSLS YVAILLMTLFANIPTFMEMKKDKIFIKKENLIRKDLELLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIM19 (NDUFA13) Rabbit Polyclonal Antibody
TA369153 100 µL

GRIM19 (NDUFA13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF405S conjugate, 0.1mg/mL
BNC041807-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS623015 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Phenylalanine ammonia-lyase Microplate Assay Kit
RDSM018 100 Assays

Phenylalanine ammonia-lyase Microplate Assay Kit

Sign In for Pricing
View Details
GPR18 (NM_001098200) Human Over-expression Lysate
LY420549 100 µg

GPR18 (NM_001098200) Human Over-expression Lysate

Sign In for Pricing
View Details
RPS6KL1 Human Gene Knockout Kit (CRISPR)
KN402641 1 Kit

RPS6KL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details