Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 45B (tmem45b)

This Recombinant Xenopus laevis Transmembrane protein 45B (tmem45b) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q6NS09

Expression Region

1-280

Origin

Xenopus laevis (African clawed frog)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGSFFLVFGLWWSVKYPLRYLNSKVKGNCRSNKCYDRLELIEGILKALFSL IGILAEQFVPDGPHMHLVNGEDHSWVKLMNWQHTTMYLFYGISGVVDILTYFPLNLPRGL DRLSLGIAVIVEGLLFYYHVHNRPALDQHIHSLLLIAVFGCAISIMIEVFMRNDIVLELF RASLSILQGTWFWQIGFVLYPLGGAPEWNQTDHDNVMFITMCFCWHYAVALLIMAINYSL VYYCVNRHKKLPVIVDNGLIKINSKKAEVEASLLAGSDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 slow qualitative filter, 90 mm
QL04A0090 Box of 100

Box of 100 slow qualitative filter, 90 mm

Sign In for Pricing
View Details
Cat SLIT and NTRK-Like Protein 6 (SLITRK6) ELISA Kit
MBS9368221 Inquire

Cat SLIT and NTRK-Like Protein 6 (SLITRK6) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD83 Antibody (MM0179-4B34) [HRP]
NBP2-12180H 0.1 mL

Mouse Monoclonal CD83 Antibody (MM0179-4B34) [HRP]

Sign In for Pricing
View Details
KCNE1 Human shRNA Plasmid Kit (Locus ID 3753)
TL312021 1 Kit

KCNE1 Human shRNA Plasmid Kit (Locus ID 3753)

Sign In for Pricing
View Details
CYP27A1 Rabbit Polyclonal Antibody (Carrier-free)
orb3111650 100 µg

CYP27A1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG123 homolog (MPN_262)
orb2924494-01 20 µg

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG123 homolog (MPN_262)

Sign In for Pricing
View Details