Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 45B (tmem45b)

This Recombinant Xenopus laevis Transmembrane protein 45B (tmem45b) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q6NS09

Expression Region

1-280

Origin

Xenopus laevis (African clawed frog)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGSFFLVFGLWWSVKYPLRYLNSKVKGNCRSNKCYDRLELIEGILKALFSL IGILAEQFVPDGPHMHLVNGEDHSWVKLMNWQHTTMYLFYGISGVVDILTYFPLNLPRGL DRLSLGIAVIVEGLLFYYHVHNRPALDQHIHSLLLIAVFGCAISIMIEVFMRNDIVLELF RASLSILQGTWFWQIGFVLYPLGGAPEWNQTDHDNVMFITMCFCWHYAVALLIMAINYSL VYYCVNRHKKLPVIVDNGLIKINSKKAEVEASLLAGSDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-4- (2-methylallyl) toluene
OR01934 1 Each

2-Chloro-4- (2-methylallyl) toluene

Sign In for Pricing
View Details
RBM34 Antibody
orb1261651 100 µL

RBM34 Antibody

Sign In for Pricing
View Details
RPGRIP1L Goat Polyclonal Antibody
TA303270 100 µg

RPGRIP1L Goat Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (phospho Ser212) Polyclonal Antibody
ABP57000-01 30 µL

MSK1 (phospho Ser212) Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (phospho Ser212) Polyclonal Antibody
ABP57000-02 100 µL

MSK1 (phospho Ser212) Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (phospho Ser212) Polyclonal Antibody
ABP57000-03 200 µL

MSK1 (phospho Ser212) Polyclonal Antibody

Sign In for Pricing
View Details