Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas atlantica Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Pseudoalteromonas atlantica Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q15P45

Expression Region

1-280

Origin

Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSYFTFPQIDPIIFSIGPLSLRWYGLMYLVGFAAAFWLAGVRLSRTNWTKEQLSDLLF WGFLGVILGGRIGYVLFYQFELFLSDPLYLFKIWTGGMSFHGGLLGVIAALWWFSRKAKC TFLQVGDFIAPLVPIGLGAGRIGNFINAELWGRTTDVSWGVIFPGAGPLPRHPSQLYEFA LEGVVLFLILWLYSRKPRPIGAVSGLFLLGYGSFRFFVEFFREPDQHIGLYEGAFSLGIS QGQILSAPMIIGGIALMVWAVRRNKMAETGVPKSSKAAKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details