Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Bicarbonate transport system permease protein CmpB (cmpB)

This Recombinant Synechocystis sp. Bicarbonate transport system permease protein CmpB (cmpB) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Bicarbonate transport system permease protein CmpB

UniProt

Q55461

Expression Region

1-280

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTISQRKNRAAGANPLQKFWRKRRGDILPPIFGILGFLLLWQLISSAGLIKLPPPSSL WTDPRTRTLLMYPFYDQGGLDKGLFWQTLASLGRVAQGYSLAAIVGISTGILVGTQPLLD KALDPIFQFLRMVAPLAWVPIALVALQQNQPAAIFVIFITSVWPILINTTEGVKQIPQDY INVRKVLRLSPQKFFFKILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIW DAYQQNYISEIILAVFYIGAVGLLLDRGIAYLQKLIAPGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sphinganine 1-phosphate
HY-113116-01 1 mg

Sphinganine 1-phosphate

Sign In for Pricing
View Details
Sphinganine 1-phosphate
HY-113116-02 5 mg

Sphinganine 1-phosphate

Sign In for Pricing
View Details
RPL35AP7 CRISPRa sgRNA lentivector (set of three targets)(Human)
41521121 3x 1.0µg DNA

RPL35AP7 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anti-NXPH1 Antibody (2E440)
TMAY-03730 100 µL

Anti-NXPH1 Antibody (2E440)

Sign In for Pricing
View Details
Horse Syncollin ELISA Kit
MBS047565-01 48 Well

Horse Syncollin ELISA Kit

Sign In for Pricing
View Details
Horse Syncollin ELISA Kit
MBS047565-02 96 Well

Horse Syncollin ELISA Kit

Sign In for Pricing
View Details