Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconobacter oxydans Undecaprenyl-diphosphatase (uppP)

This Recombinant Gluconobacter oxydans Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q5FUS6

Expression Region

1-280

Origin

Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLQALILAIVQGITEPFPVSSLGHAVLLPALLHWDLDEHAPMFLPFLTMLHVGTLVAL AGVFWRDWMAILGGMFGRYGSYRQMEAIRIFGLLVIATIPAVLVGWLLEHRLRAVFGTPL AVAGFLILNGFLLMVTEWLRRQKGHRDHKPIATLAPKDAVIIGIWQCLALLPGLSRSGAT MNGGLLRGLDHETAARFSLLMAQPIVLAATVREAWQMRHMTISHDIMVQCVAGAVVAGLT ALICSLVMLRFFRNHDGWALTPFGVYCVLAGLFAGAVILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dermatan Sulfate (>90%)
TRC-D289325-5MG 5 mg

Dermatan Sulfate (>90%)

Sign In for Pricing
View Details
FAM83A (NM_032899) Human Recombinant Protein
TP308565M 100 µg

FAM83A (NM_032899) Human Recombinant Protein

Sign In for Pricing
View Details
Kat8 Mouse Gene Knockout Kit (CRISPR)
KN308589LP 1 Kit

Kat8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(3Alpha,5Beta,7Alpha,24E)-3,7-Dihydroxy-cholest-24-en-26-oic Acid
TRC-D452838-5MG 5 mg

(3Alpha,5Beta,7Alpha,24E)-3,7-Dihydroxy-cholest-24-en-26-oic Acid

Sign In for Pricing
View Details
Cda Mouse Gene Knockout Kit (CRISPR)
KN502955 1 Kit

Cda Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(+)-Pinoresinol (>80% ee)
TRC-P468890-50MG 50 mg

(+)-Pinoresinol (>80% ee)

Sign In for Pricing
View Details