Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina mazei Cobalamin synthase (cobS)

This Recombinant Methanosarcina mazei Cobalamin synthase (cobS) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8PVB4

Expression Region

1-280

Origin

Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSYLLAFKSGFGFLSTIPVGITMEGIDELMKKIFFYPVVGAVLGLLIGIVAYAGQLVFP GPVLAALIMGFVYYITGFNHLDGVTDMGDGFMAHGSLEKKVKALKDTTLGTGGVAFGILV LLAFYGSIRSVQEEGIAAFGSNLPFLMFASMFIAEVSAKQSMLTIAAFGKPLPRLKEQTY PGLGEMTINGATRKNFLIGFIFGAVVCCLPFGLIGLIPYLAACISALVLLNRSYAHFGGL NGDGIGTANEIGRITALIVIAVTLKLSLNGYLGGLEWTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1E Polyclonal Antibody
E-AB-10950-01 20 µL

CSNK1E Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1E Polyclonal Antibody
E-AB-10950-02 60 µL

CSNK1E Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1E Polyclonal Antibody
E-AB-10950-03 120 µL

CSNK1E Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1E Polyclonal Antibody
E-AB-10950-04 200 µL

CSNK1E Polyclonal Antibody

Sign In for Pricing
View Details
Human SHISA9 activation kit by CRISPRa
GA119035 1 Kit

Human SHISA9 activation kit by CRISPRa

Sign In for Pricing
View Details
Sodium Phosphate Monobasic Anhydrous
TRC-S673260-25G 25 g

Sodium Phosphate Monobasic Anhydrous

Sign In for Pricing
View Details