Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina mazei Cobalamin synthase (cobS)

This Recombinant Methanosarcina mazei Cobalamin synthase (cobS) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8PVB4

Expression Region

1-280

Origin

Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSYLLAFKSGFGFLSTIPVGITMEGIDELMKKIFFYPVVGAVLGLLIGIVAYAGQLVFP GPVLAALIMGFVYYITGFNHLDGVTDMGDGFMAHGSLEKKVKALKDTTLGTGGVAFGILV LLAFYGSIRSVQEEGIAAFGSNLPFLMFASMFIAEVSAKQSMLTIAAFGKPLPRLKEQTY PGLGEMTINGATRKNFLIGFIFGAVVCCLPFGLIGLIPYLAACISALVLLNRSYAHFGGL NGDGIGTANEIGRITALIVIAVTLKLSLNGYLGGLEWTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin Converting Enzyme 2 (ACE 2, ACE2, ACE-2, ACE-related Carboxypeptidase, Angiotensin Converting Enzyme Homolog, ACEH, Angiotensin Converting Enzyme-like Protein, Angiotensin I Converting Enzyme (Peptidyl Dipeptidase A) 2, Angiotensin I Converting Enzyme 2, DKFZP434A014, EC 3.4.17, OTTHUMP00000022963) (AP) discontinued
A2295-02R2-AP 100 µL

Angiotensin Converting Enzyme 2 (ACE 2, ACE2, ACE-2, ACE-related Carboxypeptidase, Angiotensin Converting Enzyme Homolog, ACEH, Angiotensin Converting Enzyme-like Protein, Angiotensin I Converting Enzyme (Peptidyl Dipeptidase A) 2, Angiotensin I Converting Enzyme 2, DKFZP434A014, EC 3.4.17, OTTHUMP00000022963) (AP) discontinued

Sign In for Pricing
View Details
MAP4K4 (HGK, KIAA0687, NIK) discontinued
511335 100 µg

MAP4K4 (HGK, KIAA0687, NIK) discontinued

Sign In for Pricing
View Details
Anti-VAPA/B Antibody FL550 Conjugate
75-496-FL550 200 µL

Anti-VAPA/B Antibody FL550 Conjugate

Sign In for Pricing
View Details
FRA6G 3'UTR Luciferase Stable Cell Line
TU008197 1.0 mL

FRA6G 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Infectious Mononucleosis IgD ELISA Kit
MBS014746-01 48 Strip Well

Rat Infectious Mononucleosis IgD ELISA Kit

Sign In for Pricing
View Details
Rat Infectious Mononucleosis IgD ELISA Kit
MBS014746-02 96 Strip Well

Rat Infectious Mononucleosis IgD ELISA Kit

Sign In for Pricing
View Details