Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein HVLF6 (US12)

This Recombinant Human cytomegalovirus Uncharacterized protein HVLF6 (US12) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Uncharacterized protein HVLF6

UniProt

P09721

Expression Region

1-281

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLRSVQHFLWMVRLYGTVV FQTSATIATTILFMLIPWRVTAPYLRDTLPFWSTLLPCALRCHAYWLERRRRPGTLMLVM VYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLAWLMAWNMQRRLAILCLLSFM LPILWLFIAVQSWEPYQRIILALTVSFIYGLKIVLIRDTLTVLYRSPSNCYTDGDLLRTA MLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAHWLFHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ApoA Rabbit Monoclonal Antibody
MA1266-.05 50 µL

Anti-ApoA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
(1-Vinyl-1H-imidazol-2-yl) methanol
OR1065838-01 100 mg

(1-Vinyl-1H-imidazol-2-yl) methanol

Sign In for Pricing
View Details
(1-Vinyl-1H-imidazol-2-yl) methanol
OR1065838-02 250 mg

(1-Vinyl-1H-imidazol-2-yl) methanol

Sign In for Pricing
View Details
(1-Vinyl-1H-imidazol-2-yl) methanol
OR1065838-03 1 g

(1-Vinyl-1H-imidazol-2-yl) methanol

Sign In for Pricing
View Details
MAP-9 Polyclonal Antibody
RA27018-01 50 µL

MAP-9 Polyclonal Antibody

Sign In for Pricing
View Details
MAP-9 Polyclonal Antibody
RA27018-02 100 µL

MAP-9 Polyclonal Antibody

Sign In for Pricing
View Details