Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein HVLF6 (US12)

This Recombinant Human cytomegalovirus Uncharacterized protein HVLF6 (US12) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Uncharacterized protein HVLF6

UniProt

P09721

Expression Region

1-281

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLRSVQHFLWMVRLYGTVV FQTSATIATTILFMLIPWRVTAPYLRDTLPFWSTLLPCALRCHAYWLERRRRPGTLMLVM VYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLAWLMAWNMQRRLAILCLLSFM LPILWLFIAVQSWEPYQRIILALTVSFIYGLKIVLIRDTLTVLYRSPSNCYTDGDLLRTA MLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAHWLFHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX6 AAV Vector (Rat) (CMV)
38884106 1 µg

RFX6 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
STOML2 (Stomatin-like Protein 2, SLP-2, EPB72-like Protein 2, SLP2, HSPC108 (EPB72) -like 2, HSPC108, SLP-2) (FITC)
134009-FITC 100 µL

STOML2 (Stomatin-like Protein 2, SLP-2, EPB72-like Protein 2, SLP2, HSPC108 (EPB72) -like 2, HSPC108, SLP-2) (FITC)

Sign In for Pricing
View Details
Tekt3 (NM_027660) Mouse Tagged ORF Clone Lentiviral Particle
MR224492L4V 200 µL

Tekt3 (NM_027660) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phenophthalein glucuronide sodium salt
GC7684-1g 1 g

Phenophthalein glucuronide sodium salt

Sign In for Pricing
View Details
AAAS polyclonal antibody
orb648918-01 50 μL

AAAS polyclonal antibody

Sign In for Pricing
View Details
AAAS polyclonal antibody
orb648918-02 100 µL

AAAS polyclonal antibody

Sign In for Pricing
View Details