Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella canis Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Brucella canis Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A9M6J4

Expression Region

1-281

Origin

Brucella canis (strain ATCC 23365 / NCTC 10854)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIETLLPASALAFPAIDPVIFRIGPLAVHWYGLGYVVGILFAWWYGKKLLRSHRLWANNQ PPMAPEALDDFVIWAALGVVLGGRIGYVLFYNFSYYISNPLAIPALWDGGMSFHGGILGT TLAMILFARSRGILVWSMFDTIAAGVPIGLGVVRVANFINSELWGRVSDVPWAVYFPNGG PLPRHPSQLYEAFLEGLVLFFVLFVLVWGARKLKQPGFVAGAFVTGYGLSRIAVEFFREP DAQIGYLFGGWLTMGMVLSVPMVLLGLWAMWRANRAAARNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAD Synthetase (NADSYN1) Human Gene Knockout Kit (CRISPR)
KN400131 1 Kit

NAD Synthetase (NADSYN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Chlorophthalic Anhydride
TRC-C380578-500MG 500 mg

3-Chlorophthalic Anhydride

Sign In for Pricing
View Details
Yeats4 Mouse Gene Knockout Kit (CRISPR)
KN519545 1 Kit

Yeats4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cpxcr1 Mouse Gene Knockout Kit (CRISPR)
KN503788 1 Kit

Cpxcr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tumor necrosis factor alpha induced protein 8 like protein 2 (TNFAIP8L2) (N-term) Rabbit Polyclonal Antibody
AP54305PU-N 400 µL

Tumor necrosis factor alpha induced protein 8 like protein 2 (TNFAIP8L2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lysyl tRNA synthetase Recombinant Rabbit Monoclonal Antibody [JE40-55]
ET7109-10 100 µL

Lysyl tRNA synthetase Recombinant Rabbit Monoclonal Antibody [JE40-55]

Sign In for Pricing
View Details