Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polynucleobacter necessarius Undecaprenyl-diphosphatase (uppP)

This Recombinant Polynucleobacter necessarius Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B1XTA2

Expression Region

1-281

Origin

Polynucleobacter necessarius (strain STIR1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLILLLKAVILGVVEGLTEFLPISSTGHLILVGDLLDFNDDRGKAFEVIIQFGAILAVC WEFREKLIKVTSSFASSPNARRFVLNLFIASIPAMGLGFLFGKHIKAVLFSPIPVASAFI VGTLIIFWAERRQQNLVDVSSYIKSVDDLRPLDALKVGLAQCAALIPGTSRSGATIIGGM LFGLPRAVATEFSFFLAIPVIGGATAYELLKLWKAPVAFSGEFTLAIVVGFIAAFISAFV CVRWLIHYVAHHNFIPFAWYRIAFGILVLFTSYTGLIAWSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF-17 Polyclonal Antibody
MBS9246170-01 0.1 mL

FGF-17 Polyclonal Antibody

Sign In for Pricing
View Details
FGF-17 Polyclonal Antibody
MBS9246170-02 5x 0.1 mL

FGF-17 Polyclonal Antibody

Sign In for Pricing
View Details
ATG5 Protein Vector (Rat) (pPM-C-His)
PV255113 500 ng

ATG5 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Anti-CD10 Antibody, Mouse Monoclonal
MBS8103958-01 0.1 mL

Anti-CD10 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD10 Antibody, Mouse Monoclonal
MBS8103958-02 5x 0.1 mL

Anti-CD10 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Conjugated Aquaporin 1 Rabbit mAb
C52154 100 µL

Conjugated Aquaporin 1 Rabbit mAb

Sign In for Pricing
View Details