Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcoides burtonii Digeranylgeranylglyceryl phosphate synthase (Mbur_1679)

This Recombinant Methanococcoides burtonii Digeranylgeranylglyceryl phosphate synthase (Mbur_1679) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

Q12VF3

Expression Region

1-281

Origin

Methanococcoides burtonii (strain DSM 6242)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTYLELMRAGNCAMAAFAGLIGVLIAYNILSSASPYVSLSLFDTSLIFAIVFLVTGAGN GLNDYFDIEIDKVNKPSRPIPSGKISLKSALYFSLFLFITGITLAFLVNPLCGIIALFNS MVLILYAQSLKRTPFFGNASVGYLTGSTFLFGGAVFGMAGLQALVVLFLLATLATIAREI VKDVEDIVGDKKDGARTLPILIGAKKASYIAAAFGFTAMLASPVPYLQSILNEQYLFVVA IADIFFLIAVYQILGKKDAARSSKLFKFAMLFALISFIVGA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Sialidase-2 (Neu2)
MBS1464003-01 0.02 mg (E-Coli)

Recombinant Mouse Sialidase-2 (Neu2)

Sign In for Pricing
View Details
Recombinant Mouse Sialidase-2 (Neu2)
MBS1464003-02 0.02 mg (Yeast)

Recombinant Mouse Sialidase-2 (Neu2)

Sign In for Pricing
View Details
Recombinant Mouse Sialidase-2 (Neu2)
MBS1464003-03 0.1 mg (E-Coli)

Recombinant Mouse Sialidase-2 (Neu2)

Sign In for Pricing
View Details
Recombinant Mouse Sialidase-2 (Neu2)
MBS1464003-04 0.1 mg (Yeast)

Recombinant Mouse Sialidase-2 (Neu2)

Sign In for Pricing
View Details
Recombinant Mouse Sialidase-2 (Neu2)
MBS1464003-05 0.02 mg (Baculovirus)

Recombinant Mouse Sialidase-2 (Neu2)

Sign In for Pricing
View Details
Recombinant Mouse Sialidase-2 (Neu2)
MBS1464003-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Sialidase-2 (Neu2)

Sign In for Pricing
View Details