Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q8CWZ1

Expression Region

1-281

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFFEIIKAIIFGIVEGITEWLPISSTGHLILVEEFIHFNNANAAFTNMFNVVIQLGAIL AVVVIYFDRLNPFKSGKTAREVQITWQLWAKVILSALPAAVIGLIFDDWLDAHFQNFFSV ALMLILYGIAFIYVERRHQGVEPQVTHLVSLPYKTAFFIGLFQVLSLIPGTSRSGATILG GILLGTSRQVATEFTFFLGIPIMFGASLVKVLKFIVSGTILTGSQLFILLVAMLVAFAVS LYVIRFLTDYVKNHDFTFFGKYRIGLGILLLFYGLMKVLFG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2324106 1.0 µg DNA

SYT16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RBM11 Protein Vector (Mouse) (pPB-N-His)
PV222807 500 ng

RBM11 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal RAC3 Antibody
NBP2-32058-25ul 25 µL

Rabbit Polyclonal RAC3 Antibody

Sign In for Pricing
View Details
Human S100A3 (S100 Calcium Binding Protein A3) Microsample ELISA Kit
ELK0491MS-01 48 Tests

Human S100A3 (S100 Calcium Binding Protein A3) Microsample ELISA Kit

Sign In for Pricing
View Details
Human S100A3 (S100 Calcium Binding Protein A3) Microsample ELISA Kit
ELK0491MS-02 96 Tests

Human S100A3 (S100 Calcium Binding Protein A3) Microsample ELISA Kit

Sign In for Pricing
View Details
Human S100A3 (S100 Calcium Binding Protein A3) Microsample ELISA Kit
ELK0491MS-03 5x 96 Tests

Human S100A3 (S100 Calcium Binding Protein A3) Microsample ELISA Kit

Sign In for Pricing
View Details