Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P50012

Expression Region

1-281

Origin

Streptomyces lividans

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHAEGAAVSADPTQVLAFETDCHIFDGCGFPSPGLHSFLFEPLWGDHDSNLYFNKPMLL ALLGSIVIVGFFWAAFRKPKVVPGKLQMVAEAGYDFIRRGVVYETIGKKEGEKYVPLVVS LFFFVWMMNLWSIIPVAQFPVTSIIAYPAVLAAIVYVTWITLTFKRQGFVGFFKNVTGYD KSLGPVLPLAMLIEFFSNILIRPFTHAVRLFANMFAGHTLLLLFTIASWYLLNGVGIAYA GVSFIMTVVMTAFELFIQALQAYVFVLLTCTYIQGAMAEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM34 Rabbit Polyclonal Antibody (FITC)
orb2109570 100 µL

TOMM34 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
C3orf45 Protein Vector (Human) (pPB-His-GST)
PV331007 500 ng

C3orf45 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Anti-Clostridium novyi Toxin A/tcdA Polyclonal Antibody
PXX01201 100 μg

Anti-Clostridium novyi Toxin A/tcdA Polyclonal Antibody

Sign In for Pricing
View Details
Canine Bacillus Thuringiensis (BT) ELISA Kit
MBS9364684-01 48 Strip Well

Canine Bacillus Thuringiensis (BT) ELISA Kit

Sign In for Pricing
View Details
Canine Bacillus Thuringiensis (BT) ELISA Kit
MBS9364684-02 96 Strip Well

Canine Bacillus Thuringiensis (BT) ELISA Kit

Sign In for Pricing
View Details
Canine Bacillus Thuringiensis (BT) ELISA Kit
MBS9364684-03 5x 96 Strip Well

Canine Bacillus Thuringiensis (BT) ELISA Kit

Sign In for Pricing
View Details