Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease AarA (aarA)

This Recombinant Rhomboid protease AarA (aarA) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Rhomboid protease AarA, EC= 3.4.21.105, Intramembrane serine protease

UniProt

P46116

Expression Region

1-281

Origin

Providencia stuartii

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIY QLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAAL FSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQR RQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITV IAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Unknown tissue
CS620933 5x 5 µm

Frozen Tissue Sections, Unknown tissue

Sign In for Pricing
View Details
12-Hydroxystearic Acid Lithium Salt
TRC-H953785-5G 5 g

12-Hydroxystearic Acid Lithium Salt

Sign In for Pricing
View Details
FUT8 Human Gene Knockout Kit (CRISPR)
KN212345 1 Kit

FUT8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Ethylbenzoic acid
TRC-E899815-2.5G 2.5 g

4-Ethylbenzoic acid

Sign In for Pricing
View Details
GSK3 beta Antibody
KC-6249-01 50 μL

GSK3 beta Antibody

Sign In for Pricing
View Details
GSK3 beta Antibody
KC-6249-02 100 µL

GSK3 beta Antibody

Sign In for Pricing
View Details