Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease AarA (aarA)

This Recombinant Rhomboid protease AarA (aarA) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Rhomboid protease AarA, EC= 3.4.21.105, Intramembrane serine protease

UniProt

P46116

Expression Region

1-281

Origin

Providencia stuartii

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIY QLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAAL FSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQR RQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITV IAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM6 (Proliferation Marker) (MCM6/3000), CF568 conjugate, 0.1mg/mL
BNC683000-500 1x 500 µL

MCM6 (Proliferation Marker) (MCM6/3000), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NT5C3 (NT5C3A) (NM_001002009) Human Over-expression Lysate
LY424318 100 µg

NT5C3 (NT5C3A) (NM_001002009) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS504950 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Yipf7 Mouse Gene Knockout Kit (CRISPR)
KN519555 1 Kit

Yipf7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phthalic-13C6 Anhydride
TRC-P384489-10MG 10 mg

Phthalic-13C6 Anhydride

Sign In for Pricing
View Details
SKF 81297C
TRC-S550020-5MG 5 mg

SKF 81297C

Sign In for Pricing
View Details