Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q0WFU0

Expression Region

1-282

Origin

Yersinia pestis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIMFREGLEAALIVSLIASYLKRTQRGQWMGAVWVGVVVAAVLCLAIGIFINETT GEFPQKQQELFEGIIAVVAVCILTYMVFWMRKVSKSVKVHLEGAIDNALNSGRGQGWALV AMVFFAVAREGLESVFFLLAAFQQDVGIGAPIGAILGLVCAILVGMAIYWGGVKLHLAKF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQDIAFDLTDVLSTHSLLGTFLEGMFGYQ EAPTVSEVSVYFIYLIPALILFFLPPRSTAGSAIAAARKINP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ftl1 activation kit by CRISPRa
GA201483 1 Kit

Mouse Ftl1 activation kit by CRISPRa

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF568 conjugate, 0.1mg/mL
BNC681825-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican 4 (GPC4) Mouse Monoclonal Antibody [Clone ID: AT51E3]
AP33507PU-S 50 µL

Glypican 4 (GPC4) Mouse Monoclonal Antibody [Clone ID: AT51E3]

Sign In for Pricing
View Details
Hepsin (HPN) Rabbit Polyclonal Antibody
TA369157 100 µL

Hepsin (HPN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAF12 Human Gene Knockout Kit (CRISPR)
KN402055 1 Kit

TAF12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGFL2 (NM_001002915) Human Over-expression Lysate
LC424111 20 µg

IGFL2 (NM_001002915) Human Over-expression Lysate

Sign In for Pricing
View Details